Lineage for d1ypua_ (1ypu A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443271Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)
  8. 1443379Domain d1ypua_: 1ypu A: [123835]
    automated match to d1hyra_

Details for d1ypua_

PDB Entry: 1ypu (more details), 2.05 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 C2 Space Group
PDB Compounds: (A:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypua_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyss
fpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencila
afsicqkkanl

SCOPe Domain Coordinates for d1ypua_:

Click to download the PDB-style file with coordinates for d1ypua_.
(The format of our PDB-style files is described here.)

Timeline for d1ypua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ypub_