SCOPe 2.04: Domain d1ypqa1: 1ypq A:140-270

Lineage for d1ypqa1 (1ypq A:140-270)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Oxidised low density lipoprotein [143955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143956] (1 PDB entry)
   Uniprot P78380 140-270

8. Domain d1ypqa1: 1ypq A:140-270 [123833]
   Other proteins in same PDB: d1ypqb_
   complexed with dio

Details for d1ypqa1

PDB Entry: 1ypq, 1.4 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 Dioxane Complex

PDB Compounds: (A:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypqa1:

Sequence; same for both SEQRES and ATOM records:

>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]}
csapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyss
fpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencila
afsicqkkanl

Timeline for d1ypqa1:

• d1ypqa1 first appeared in SCOP 1.73
  
• d1ypqa1 appears in SCOPe 2.03
  
• d1ypqa1 appears in SCOPe 2.05
  
• d1ypqa1 appears in the current release, SCOPe 2.08