Lineage for d1ypqa1 (1ypq A:140-270)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2558907Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2559194Protein Oxidised low density lipoprotein [143955] (1 species)
  7. 2559195Species Human (Homo sapiens) [TaxId:9606] [143956] (1 PDB entry)
    Uniprot P78380 140-270
  8. 2559196Domain d1ypqa1: 1ypq A:140-270 [123833]
    Other proteins in same PDB: d1ypqb_
    complexed with dio

Details for d1ypqa1

PDB Entry: 1ypq (more details), 1.4 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 Dioxane Complex
PDB Compounds: (A:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]}
csapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyss
fpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencila
afsicqkkanl

SCOPe Domain Coordinates for d1ypqa1:

Click to download the PDB-style file with coordinates for d1ypqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ypqa1: