Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Oxidised low density lipoprotein [143955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143956] (2 PDB entries) Uniprot P78380 140-270 |
Domain d1ypof1: 1ypo F:142-270 [123830] automatically matched to 1YPQ A:140-270 |
PDB Entry: 1ypo (more details), 3 Å
SCOPe Domain Sequences for d1ypof1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypof1 d.169.1.1 (F:142-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf sicqkkanl
Timeline for d1ypof1: