SCOPe 2.08: Domain d1ypoc2: 1ypo C:142-272

Lineage for d1ypoc2 (1ypo C:142-272)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d1ypoc2: 1ypo C:142-272 [123827]
   Other proteins in same PDB: d1ypob3, d1ypoc3, d1ypog3
   automated match to d1yxja_

Details for d1ypoc2

PDB Entry: 1ypo, 3 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 P3 1 21 Space Group

PDB Compounds: (C:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypoc2:

Sequence; same for both SEQRES and ATOM records:

>d1ypoc2 d.169.1.0 (C:142-272) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
sicqkkanlra

Timeline for d1ypoc2:

• d1ypoc2 first appeared in SCOP 1.73, called d1ypoc1
  
• d1ypoc2 was called d1ypoc_ in SCOPe 2.07