Lineage for d1yoya1 (1yoy A:7-172)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780221Family a.211.1.1: HD domain [101340] (13 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 780226Protein Hypothetical protein AF1432 [140763] (1 species)
  7. 780227Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [140764] (2 PDB entries)
    Uniprot O28840 7-172! Uniprot O28840 7-173
  8. 780231Domain d1yoya1: 1yoy A:7-172 [123795]

Details for d1yoya1

PDB Entry: 1yoy (more details), 2 Å

PDB Description: predicted coding region af1432 from archaeoglobus fulgidus
PDB Compounds: (A:) hypothetical protein AF1432

SCOP Domain Sequences for d1yoya1:

Sequence, based on SEQRES records: (download)

>d1yoya1 a.211.1.1 (A:7-172) Hypothetical protein AF1432 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mddvvkfihevgslkltprsgwlklgirlpesvaehsfraaiiafilalksgesvekack
aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvww

Sequence, based on observed residues (ATOM records): (download)

>d1yoya1 a.211.1.1 (A:7-172) Hypothetical protein AF1432 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mddvvkfihevgslkltprsgwlklgirlpesvaehsfraaiiafilalksgesvekack
aataalfhdlheareeqlswmeskpdfsdvevyvsdadklelafqgveysqqvsyairfa
envelktdaakeiyrvlmerknpvww

SCOP Domain Coordinates for d1yoya1:

Click to download the PDB-style file with coordinates for d1yoya1.
(The format of our PDB-style files is described here.)

Timeline for d1yoya1: