Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins automatically mapped to Pfam PF04092 |
Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (2 proteins) |
Domain d1yntg2: 1ynt G:3132-3254 [123761] Other proteins in same PDB: d1ynta1, d1ynta2, d1yntb1, d1yntc1, d1yntc2, d1yntd1, d1ynte_ automated match to d1kzqa2 complexed with cd |
PDB Entry: 1ynt (more details), 3.1 Å
SCOPe Domain Sequences for d1yntg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yntg2 b.6.2.1 (G:3132-3254) automated matches {Toxoplasma gondii [TaxId: 5811]} assvvnnvarcsygadstlgpvklsaegpttmtlvcgkdgvkvpqdnnqycsgttltgcn eksfkdilpkltenpwqgnassdkgatltikkeafpaesksviigctggspekhhctvkl efa
Timeline for d1yntg2: