![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) ![]() SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins |
![]() | Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (1 protein) |
![]() | Protein Major surface antigen p30, SAG1 [74879] (1 species) duplication: tandem repeat of two homologous domains |
![]() | Species Toxoplasma gondii [TaxId:5811] [74880] (2 PDB entries) |
![]() | Domain d1yntf1: 1ynt F:2003-2131 [123758] Other proteins in same PDB: d1yntb1, d1yntd1, d1ynte1 automatically matched to d1kzqa1 complexed with cd |
PDB Entry: 1ynt (more details), 3.1 Å
SCOP Domain Sequences for d1yntf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yntf1 b.6.2.1 (F:2003-2131) Major surface antigen p30, SAG1 {Toxoplasma gondii [TaxId: 5811]} plvanqvvtcpdkkstaaviltptenhftlkcpktaltepptlayspnrqicpagttssc tskavtlsslipeaedswwtgdsasldtagikltvpiekfpvttqtfvvgcikgddaqsc mvtvtvqar
Timeline for d1yntf1: