| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) ![]() SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins automatically mapped to Pfam PF04092 |
| Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (2 proteins) |
| Domain d1yntf1: 1ynt F:2003-2131 [123758] Other proteins in same PDB: d1ynta1, d1ynta2, d1yntb1, d1yntb2, d1yntc1, d1yntc2, d1yntd1, d1yntd2, d1ynte_ automated match to d1kzqa1 complexed with cd |
PDB Entry: 1ynt (more details), 3.1 Å
SCOPe Domain Sequences for d1yntf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yntf1 b.6.2.1 (F:2003-2131) automated matches {Toxoplasma gondii [TaxId: 5811]}
plvanqvvtcpdkkstaaviltptenhftlkcpktaltepptlayspnrqicpagttssc
tskavtlsslipeaedswwtgdsasldtagikltvpiekfpvttqtfvvgcikgddaqsc
mvtvtvqar
Timeline for d1yntf1: