Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries) |
Domain d1ynte_: 1ynt E: [123757] Other proteins in same PDB: d1ynta1, d1ynta2, d1yntb1, d1yntc1, d1yntc2, d1yntd1, d1yntf1, d1yntf2, d1yntg1, d1yntg2 automated match to d1heze_ complexed with cd |
PDB Entry: 1ynt (more details), 3.1 Å
SCOPe Domain Sequences for d1ynte_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynte_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]} evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf a
Timeline for d1ynte_: