SCOP 1.73: Domain d1yntd1: 1ynt D:1619-1718

Lineage for d1yntd1 (1ynt D:1619-1718)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1yntd1: 1ynt D:1619-1718 [123756]
   Other proteins in same PDB: d1ynte1, d1yntf1, d1yntf2, d1yntg1, d1yntg2
   automatically matched to d1mj8h2
   complexed with cd

Details for d1yntd1

PDB Entry: 1ynt, 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab

PDB Compounds: (D:) 4F11E12 Fab variable heavy chain region

SCOP Domain Sequences for d1yntd1:

Sequence; same for both SEQRES and ATOM records:

>d1yntd1 b.1.1.2 (D:1619-1718) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1yntd1:

• d1yntd1 is new in SCOP 1.73
  
• d1yntd1 appears in SCOP 1.75
  
• d1yntd1 appears in the current release, SCOPe 2.08