Lineage for d1yntb1 (1ynt B:619-718)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655744Domain d1yntb1: 1ynt B:619-718 [123755]
    Other proteins in same PDB: d1ynte1, d1yntf1, d1yntf2, d1yntg1, d1yntg2
    automatically matched to d1mj8h2
    complexed with cd

Details for d1yntb1

PDB Entry: 1ynt (more details), 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
PDB Compounds: (B:) 4F11E12 Fab variable heavy chain region

SCOP Domain Sequences for d1yntb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yntb1 b.1.1.2 (B:619-718) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1yntb1:

Click to download the PDB-style file with coordinates for d1yntb1.
(The format of our PDB-style files is described here.)

Timeline for d1yntb1: