Lineage for d1ynrd_ (1ynr D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 904799Protein Cytochrome c552 [46636] (5 species)
  7. 904800Species Hydrogenobacter thermophilus [TaxId:940] [46640] (3 PDB entries)
  8. 904804Domain d1ynrd_: 1ynr D: [123753]
    automated match to d1ayg__
    complexed with hec, mpd, so4

Details for d1ynrd_

PDB Entry: 1ynr (more details), 2 Å

PDB Description: Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution
PDB Compounds: (D:) Cytochrome c-552

SCOPe Domain Sequences for d1ynrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynrd_ a.3.1.1 (D:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsi

SCOPe Domain Coordinates for d1ynrd_:

Click to download the PDB-style file with coordinates for d1ynrd_.
(The format of our PDB-style files is described here.)

Timeline for d1ynrd_: