Lineage for d1ynrd1 (1ynr D:1-79)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 633914Protein Cytochrome c552 [46636] (5 species)
  7. 633915Species Hydrogenobacter thermophilus [TaxId:940] [46640] (3 PDB entries)
  8. 633919Domain d1ynrd1: 1ynr D:1-79 [123753]
    automatically matched to d1ayg__
    complexed with hec, mpd, so4

Details for d1ynrd1

PDB Entry: 1ynr (more details), 2 Å

PDB Description: Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution
PDB Compounds: (D:) Cytochrome c-552

SCOP Domain Sequences for d1ynrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynrd1 a.3.1.1 (D:1-79) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsi

SCOP Domain Coordinates for d1ynrd1:

Click to download the PDB-style file with coordinates for d1ynrd1.
(The format of our PDB-style files is described here.)

Timeline for d1ynrd1: