Lineage for d1ynrc1 (1ynr C:1-80)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760741Protein Cytochrome c552 [46636] (5 species)
  7. 760742Species Hydrogenobacter thermophilus [TaxId:940] [46640] (3 PDB entries)
  8. 760745Domain d1ynrc1: 1ynr C:1-80 [123752]
    automatically matched to d1ayg__
    complexed with hec, mpd, so4

Details for d1ynrc1

PDB Entry: 1ynr (more details), 2 Å

PDB Description: Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution
PDB Compounds: (C:) Cytochrome c-552

SCOP Domain Sequences for d1ynrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynrc1 a.3.1.1 (C:1-80) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik

SCOP Domain Coordinates for d1ynrc1:

Click to download the PDB-style file with coordinates for d1ynrc1.
(The format of our PDB-style files is described here.)

Timeline for d1ynrc1: