SCOPe 2.01: Domain d1ynbc_: 1ynb C:

Lineage for d1ynbc_ (1ynb C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.1: HD domain [101340] (14 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Hypothetical protein AF1432 [140763] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [140764] (2 PDB entries)
   Uniprot O28840 7-172! Uniprot O28840 7-173

8. Domain d1ynbc_: 1ynb C: [123720]
   automated match to d1ynba1

Details for d1ynbc_

PDB Entry: 1ynb, 1.76 Å

PDB Description: crystal structure of genomics APC5600

PDB Compounds: (C:) hypothetical protein AF1432

SCOPe Domain Sequences for d1ynbc_:

Sequence; same for both SEQRES and ATOM records:

>d1ynbc_ a.211.1.1 (C:) Hypothetical protein AF1432 {Archaeoglobus fulgidus [TaxId: 2234]}
mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack
aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr

Timeline for d1ynbc_:

• d1ynbc_ first appeared in SCOP 1.73, called d1ynbc1
  
• d1ynbc_ was called d1ynbc1 in SCOP 1.75
  
• d1ynbc_ appears in SCOPe 2.02
  
• d1ynbc_ appears in the current release, SCOPe 2.08