SCOP 1.75: Domain d1ynba1: 1ynb A:7-173

Lineage for d1ynba1 (1ynb A:7-173)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.1: HD domain [101340] (13 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Hypothetical protein AF1432 [140763] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [140764] (2 PDB entries)
   Uniprot O28840 7-172! Uniprot O28840 7-173

8. Domain d1ynba1: 1ynb A:7-173 [123718]

Details for d1ynba1

PDB Entry: 1ynb, 1.76 Å

PDB Description: crystal structure of genomics APC5600

PDB Compounds: (A:) hypothetical protein AF1432

SCOP Domain Sequences for d1ynba1:

Sequence; same for both SEQRES and ATOM records:

>d1ynba1 a.211.1.1 (A:7-173) Hypothetical protein AF1432 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack
aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr

Timeline for d1ynba1:

• d1ynba1 first appeared in SCOP 1.73
  
• d1ynba1 appears in SCOPe 2.01
  
• d1ynba1 appears in the current release, SCOPe 2.08