Lineage for d1yn6b_ (1yn6 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1758823Protein beta2-microglobulin [88600] (5 species)
  7. 1759459Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries)
    Uniprot P01887
  8. 1759542Domain d1yn6b_: 1yn6 B: [123714]
    Other proteins in same PDB: d1yn6a1, d1yn6a2
    automated match to d1bz9b_

Details for d1yn6b_

PDB Entry: 1yn6 (more details), 2.2 Å

PDB Description: Crystal structure of a mouse MHC class I protein, H2-Db, in complex with a peptide from the influenza A acid polymerase
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1yn6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yn6b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1yn6b_:

Click to download the PDB-style file with coordinates for d1yn6b_.
(The format of our PDB-style files is described here.)

Timeline for d1yn6b_: