Lineage for d1ymyb2 (1ymy B:54-350)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 817102Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)
  6. 817103Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (3 species)
  7. 817107Species Escherichia coli [TaxId:562] [141808] (4 PDB entries)
    Uniprot P0AF18 54-350
  8. 817117Domain d1ymyb2: 1ymy B:54-350 [123711]
    Other proteins in same PDB: d1ymya1, d1ymyb1
    automatically matched to 1YMY A:54-350

Details for d1ymyb2

PDB Entry: 1ymy (more details), 2.6 Å

PDB Description: Crystal Structure of the N-Acetylglucosamine-6-phosphate deacetylase from Escherichia coli K12
PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOP Domain Sequences for d1ymyb2:

Sequence, based on SEQRES records: (download)

>d1ymyb2 c.1.9.10 (B:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]}
gfidvqlngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrv
mreylakhpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlap
emvpaevisklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglag
aildeadiycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiy
yrnglcvdengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlg

Sequence, based on observed residues (ATOM records): (download)

>d1ymyb2 c.1.9.10 (B:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]}
gfidvqlngcggvqfavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreyl
akhpnqalglhlegpwlnlaalvdflcenadvitkvtlapemvpaevisklanagivvsa
ghsnatlkeakagfragitfathlynampyitgrepglagaildeadiycgiiadglhvd
yanirnakrlkgdklclvtdatagssltmiegvrnlvehcgialdevlrmatlyparaig
vekrlg

SCOP Domain Coordinates for d1ymyb2:

Click to download the PDB-style file with coordinates for d1ymyb2.
(The format of our PDB-style files is described here.)

Timeline for d1ymyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ymyb1