SCOPe 2.06: Domain d1ymme2: 1ymm E:123-246

Lineage for d1ymme2 (1ymm E:123-246)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)

8. Domain d1ymme2: 1ymm E:123-246 [123706]
   Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymmb2, d1ymmd1, d1ymme1
   automatically matched to d1ogae2
   complexed with nag

Details for d1ymme2

PDB Entry: 1ymm, 3.5 Å

PDB Description: tcr/hla-dr2b/mbp-peptide complex

PDB Compounds: (E:) T-cell receptor beta chain

SCOPe Domain Sequences for d1ymme2:

Sequence; same for both SEQRES and ATOM records:

>d1ymme2 b.1.1.2 (E:123-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgr

Timeline for d1ymme2:

• d1ymme2 first appeared in SCOP 1.73
  
• d1ymme2 appears in SCOPe 2.05
  
• d1ymme2 appears in SCOPe 2.07
  
• d1ymme2 appears in the current release, SCOPe 2.08