Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) |
Domain d1ymme2: 1ymm E:123-246 [123706] Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymmb2, d1ymmd1, d1ymme1 automatically matched to d1ogae2 complexed with nag |
PDB Entry: 1ymm (more details), 3.5 Å
SCOPe Domain Sequences for d1ymme2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymme2 b.1.1.2 (E:123-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae awgr
Timeline for d1ymme2: