![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (12 PDB entries) |
![]() | Domain d1ymmb2: 1ymm B:3-92 [123704] Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymme1, d1ymme2 automatically matched to d1bx2b2 complexed with nag; mutant |
PDB Entry: 1ymm (more details), 3.5 Å
SCOP Domain Sequences for d1ymmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymmb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn sqkdileqaraavdtycrhnygvvesftvq
Timeline for d1ymmb2:
![]() Domains from other chains: (mouse over for more information) d1ymma1, d1ymma2, d1ymme1, d1ymme2 |