Lineage for d1ymmb1 (1ymm B:93-189)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515012Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1515020Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (40 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1515080Domain d1ymmb1: 1ymm B:93-189 [123703]
    Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb2, d1ymmd1, d1ymme1, d1ymme2
    automatically matched to d1bx2b1
    complexed with nag

Details for d1ymmb1

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: tcr/hla-dr2b/mbp-peptide complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DR beta chain

SCOPe Domain Sequences for d1ymmb1:

Sequence, based on SEQRES records: (download)

>d1ymmb1 b.1.1.2 (B:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewr

Sequence, based on observed residues (ATOM records): (download)

>d1ymmb1 b.1.1.2 (B:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvqpkvtvypsllvcsvsgfypgsievrwflngqeekagmvstgliqngdwtfqtlvml
etvprsgevytcqvehpsvtspltvewr

SCOPe Domain Coordinates for d1ymmb1:

Click to download the PDB-style file with coordinates for d1ymmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ymmb1: