Lineage for d1ymmb1 (1ymm B:93-189)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784902Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 784910Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 784968Domain d1ymmb1: 1ymm B:93-189 [123703]
    Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb2, d1ymmd1, d1ymme1, d1ymme2
    automatically matched to d1bx2b1
    complexed with nag; mutant

Details for d1ymmb1

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: TCR/HLA-DR2b/MBP-peptide complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DR beta chain

SCOP Domain Sequences for d1ymmb1:

Sequence, based on SEQRES records: (download)

>d1ymmb1 b.1.1.2 (B:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewr

Sequence, based on observed residues (ATOM records): (download)

>d1ymmb1 b.1.1.2 (B:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvqpkvtvypsllvcsvsgfypgsievrwflngqeekagmvstgliqngdwtfqtlvml
etvprsgevytcqvehpsvtspltvewr

SCOP Domain Coordinates for d1ymmb1:

Click to download the PDB-style file with coordinates for d1ymmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ymmb1: