SCOPe 2.01: Domain d1ymma1: 1ymm A:83-179

Lineage for d1ymma1 (1ymm A:83-179)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
probably orthologous to the human HLA-DQ group
Domain d1ymma1: 1ymm A:83-179 [123701]
Other proteins in same PDB: d1ymma2, d1ymmb1, d1ymmb2, d1ymmd1, d1ymme1, d1ymme2
automatically matched to d1k2da1
complexed with nag

Details for d1ymma1

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: tcr/hla-dr2b/mbp-peptide complex

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1ymma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymma1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOPe Domain Coordinates for d1ymma1:

Click to download the PDB-style file with coordinates for d1ymma1.
(The format of our PDB-style files is described here.)

Timeline for d1ymma1: