Lineage for d1ym7c3 (1ym7 C:186-549)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735174Protein G-protein coupled receptor kinase 2 [90034] (1 species)
    AGC group; GRKs subfamily; serine/threonine kinase
  7. 735175Species Cow (Bos taurus) [TaxId:9913] [90035] (3 PDB entries)
  8. 735180Domain d1ym7c3: 1ym7 C:186-549 [123693]
    Other proteins in same PDB: d1ym7a1, d1ym7a2, d1ym7b1, d1ym7b2, d1ym7c1, d1ym7c2, d1ym7d1, d1ym7d2
    automatically matched to d1omwa3
    mutant

Details for d1ym7c3

PDB Entry: 1ym7 (more details), 4.5 Å

PDB Description: G Protein-Coupled Receptor Kinase 2 (GRK2)
PDB Compounds: (C:) Beta-adrenergic receptor kinase 1

SCOP Domain Sequences for d1ym7c3:

Sequence, based on SEQRES records: (download)

>d1ym7c3 d.144.1.7 (C:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d1ym7c3 d.144.1.7 (C:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgkgiklldsdq
elyrnfpltiserwqqevaetvfdtinaetdrlearkktknkqlgh

SCOP Domain Coordinates for d1ym7c3:

Click to download the PDB-style file with coordinates for d1ym7c3.
(The format of our PDB-style files is described here.)

Timeline for d1ym7c3: