SCOPe 2.01: Domain d1ylod2: 1ylo D:1-66,D:148-345

Lineage for d1ylod2 (1ylo D:1-66,D:148-345)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Aminopeptidase YpdE [142520] (1 species)

7. Species Shigella flexneri [TaxId:623] [142521] (1 PDB entry)
   Uniprot Q83K87 1-66,148-345
   hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt)

8. Domain d1ylod2: 1ylo D:1-66,D:148-345 [123666]
   Other proteins in same PDB: d1yloa1, d1ylob1, d1yloc1, d1ylod1, d1yloe1, d1ylof1
   automatically matched to 1YLO A:1-66,A:148-345
   complexed with zn

Details for d1ylod2

PDB Entry: 1ylo, 2.15 Å

PDB Description: crystal structure of protein of unknown function (possible aminopeptidase) s2589 from shigella flexneri 2a str. 2457t

PDB Compounds: (D:) hypothetical protein SF2450

SCOPe Domain Sequences for d1ylod2:

Sequence; same for both SEQRES and ATOM records:

>d1ylod2 c.56.5.4 (D:1-66,D:148-345) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]}
mdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmic
ahmdevXfdttfqvlphqrvmgkafddrlscyllvtllrelhdaelpaevwlvassseev
glrggqtatravspdvaivldtacwaknfdygaanhrqigngpmlvlsdksliappklta
wietvaaeigvplqadmfsnggtdggavhltgtgvptlvmgpatrhghcaasiadcrdil
qmeqllsaliqrltretvvqltdfr

Timeline for d1ylod2:

• d1ylod2 first appeared in SCOP 1.73
  
• d1ylod2 appears in SCOP 1.75
  
• d1ylod2 appears in SCOPe 2.02
  
• d1ylod2 appears in the current release, SCOPe 2.08