Lineage for d1yllb1 (1yll B:3-196)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810125Family b.82.1.17: PA5104-like [141609] (1 protein)
    Pfam PF05962; DUF886; duplication: consists of two germin-like domains; overall structural similarity to the YlbA-like family ((101979)) except a deletion in the interdomain linker region
  6. 810126Protein Hypothetical protein PA5104 [141610] (1 species)
  7. 810127Species Pseudomonas aeruginosa [TaxId:287] [141611] (1 PDB entry)
    Uniprot Q9HU79 2-196
  8. 810129Domain d1yllb1: 1yll B:3-196 [123654]
    automatically matched to 1YLL A:2-196

Details for d1yllb1

PDB Entry: 1yll (more details), 1.64 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function PA5104 from Pseudomonas aeruginosa PAO1
PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d1yllb1:

Sequence, based on SEQRES records: (download)

>d1yllb1 b.82.1.17 (B:3-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]}
elrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqri
isvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarl
qwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlta
hepawvcaveldsl

Sequence, based on observed residues (ATOM records): (download)

>d1yllb1 b.82.1.17 (B:3-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]}
elrilravdyprmpwkngagsteeiardgfgwrlsiadvgesggfsgfagyqriisvleg
ggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarlqwlrve
geldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrltahepawv
caveldsl

SCOP Domain Coordinates for d1yllb1:

Click to download the PDB-style file with coordinates for d1yllb1.
(The format of our PDB-style files is described here.)

Timeline for d1yllb1: