Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.55: Transcriptional regulator Rrf2 [109699] (2 proteins) Pfam PF02082 |
Protein Hypothetical protein BC1842 [140275] (1 species) |
Species Bacillus cereus [TaxId:1396] [140276] (1 PDB entry) Uniprot Q81EX1 5-142 |
Domain d1ylfc1: 1ylf C:6-142 [123650] automatically matched to 1YLF A:5-142 complexed with cl |
PDB Entry: 1ylf (more details), 2.5 Å
SCOP Domain Sequences for d1ylfc1:
Sequence, based on SEQRES records: (download)
>d1ylfc1 a.4.5.55 (C:6-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg agllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiiliqaqsame evlrnitmgqlfetlqe
>d1ylfc1 a.4.5.55 (C:6-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg agllkdlheitlldvyhavnvganiqavleiiliqaqsameevlrnitmgqlfetlqe
Timeline for d1ylfc1: