![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (33 PDB entries) |
![]() | Domain d1ylca1: 1ylc A:16-245 [123645] automatically matched to d3tgje_ complexed with aba, ca, so4; mutant |
PDB Entry: 1ylc (more details), 1.7 Å
SCOP Domain Sequences for d1ylca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylca1 b.47.1.2 (A:16-245) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
Timeline for d1ylca1: