Lineage for d1ylab1 (1yla B:157-199)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1723911Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1723935Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1723936Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1724017Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 1724018Species Human (Homo sapiens) [TaxId:9606] [140328] (6 PDB entries)
    Uniprot P61086 157-198
  8. 1724023Domain d1ylab1: 1yla B:157-199 [123643]
    Other proteins in same PDB: d1ylaa2, d1ylab2
    automated match to d1ylaa1

Details for d1ylab1

PDB Entry: 1yla (more details), 2.4 Å

PDB Description: Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d1ylab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylab1 a.5.2.1 (B:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatellls

SCOPe Domain Coordinates for d1ylab1:

Click to download the PDB-style file with coordinates for d1ylab1.
(The format of our PDB-style files is described here.)

Timeline for d1ylab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylab2