Lineage for d1yl7h1 (1yl7 H:2-105,H:215-245)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687331Protein Dihydrodipicolinate reductase [51821] (3 species)
  7. 687341Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries)
  8. 687355Domain d1yl7h1: 1yl7 H:2-105,H:215-245 [123639]
    Other proteins in same PDB: d1yl7a2, d1yl7b2, d1yl7c2, d1yl7d2, d1yl7e2, d1yl7f2, d1yl7g2, d1yl7h2
    automatically matched to d1c3va1
    complexed with mg, nad

Details for d1yl7h1

PDB Entry: 1yl7 (more details), 2.34 Å

PDB Description: the crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) in complex with nadh (crystal form c)
PDB Compounds: (H:) dihydrodipicolinate reductase

SCOP Domain Sequences for d1yl7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl7h1 c.2.1.3 (H:2-105,H:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
rvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmgn
leflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrria
erpgltvgleplldlh

SCOP Domain Coordinates for d1yl7h1:

Click to download the PDB-style file with coordinates for d1yl7h1.
(The format of our PDB-style files is described here.)

Timeline for d1yl7h1: