Lineage for d1yl4e1 (1yl4 E:7-240)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692769Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 692770Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 692771Protein Ribosomal protein S2 [52315] (2 species)
  7. 692781Species Thermus thermophilus [TaxId:274] [52316] (36 PDB entries)
  8. 692813Domain d1yl4e1: 1yl4 E:7-240 [123596]
    Other proteins in same PDB: d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1
    automatically matched to d1i94b_

Details for d1yl4e1

PDB Entry: 1yl4 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3
PDB Compounds: (E:) 30S ribosomal protein S2

SCOP Domain Sequences for d1yl4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl4e1 c.23.15.1 (E:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1yl4e1:

Click to download the PDB-style file with coordinates for d1yl4e1.
(The format of our PDB-style files is described here.)

Timeline for d1yl4e1: