SCOPe 2.02: Domain d1yl3w1: 1yl3 W:1-65

Lineage for d1yl3w1 (1yl3 W:1-65)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries)
   Uniprot Q5SHP6 12-62

8. Domain d1yl3w1: 1yl3 W:1-65 [123594]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3x1
   automatically matched to d1ffks_

Details for d1yl3w1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (W:) 50S ribosomal protein L29

SCOPe Domain Sequences for d1yl3w1:

Sequence, based on SEQRES records:

>d1yl3w1 a.2.2.1 (W:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Sequence, based on observed residues (ATOM records):

>d1yl3w1 a.2.2.1 (W:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
eegd

Timeline for d1yl3w1:

• d1yl3w1 first appeared in SCOP 1.73
  
• d1yl3w1 appears in SCOPe 2.01
  
• d1yl3w1 appears in SCOPe 2.03
  
• d1yl3w1 appears in the current release, SCOPe 2.08