Lineage for d1yl3k1 (1yl3 K:56-149)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573816Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 2573817Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
    automatically mapped to Pfam PF03948
  5. 2573818Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 2573819Protein Ribosomal protein L9 C-domain [55655] (3 species)
  7. 2573852Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
    Uniprot Q5SLQ1 55-146
  8. 2573858Domain d1yl3k1: 1yl3 K:56-149 [123584]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3k1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (K:) 50S ribosomal protein L9

SCOPe Domain Sequences for d1yl3k1:

Sequence, based on SEQRES records: (download)

>d1yl3k1 d.99.1.1 (K:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Sequence, based on observed residues (ATOM records): (download)

>d1yl3k1 d.99.1.1 (K:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk

SCOPe Domain Coordinates for d1yl3k1:

Click to download the PDB-style file with coordinates for d1yl3k1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3k1: