Lineage for d1yl3d2 (1yl3 D:60-125)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668391Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    incomplete OB-fold lacking the last strand
  7. 668433Species Bacillus stearothermophilus [TaxId:1422] [50300] (2 PDB entries)
  8. 668436Domain d1yl3d2: 1yl3 D:60-125 [123576]
    Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
    automatically matched to d1rl2a2

Details for d1yl3d2

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (D:) 50S ribosomal protein L2

SCOP Domain Sequences for d1yl3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3d2 b.40.4.5 (D:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadiki

SCOP Domain Coordinates for d1yl3d2:

Click to download the PDB-style file with coordinates for d1yl3d2.
(The format of our PDB-style files is described here.)

Timeline for d1yl3d2: