Lineage for d1yl301 (1yl3 0:14-118)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238107Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 2238108Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 2238109Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 2238110Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 2238148Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 2238164Domain d1yl301: 1yl3 0:14-118 [123574]
    Other proteins in same PDB: d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl301

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (0:) 50S ribosomal protein L17

SCOPe Domain Sequences for d1yl301:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl301 d.188.1.1 (0:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d1yl301:

Click to download the PDB-style file with coordinates for d1yl301.
(The format of our PDB-style files is described here.)

Timeline for d1yl301: