SCOPe 2.02: Domain d1ykbd_: 1ykb D:

Lineage for d1ykbd_ (1ykb D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-22 (IL-22) [89036] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)

8. Domain d1ykbd_: 1ykb D: [123506]
   automated match to d1m4ra_
   complexed with nag

Details for d1ykbd_

PDB Entry: 1ykb, 2.6 Å

PDB Description: crystal structure of insect cell expressed il-22

PDB Compounds: (D:) PROTEIN (Interleukin-22)

SCOPe Domain Sequences for d1ykbd_:

Sequence; same for both SEQRES and ATOM records:

>d1ykbd_ a.26.1.3 (D:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
sgeikaigeldllfmslrnaci

Timeline for d1ykbd_:

• d1ykbd_ first appeared in SCOP 1.73, called d1ykbd1
  
• d1ykbd_ appears in SCOPe 2.01
  
• d1ykbd_ appears in SCOPe 2.03
  
• d1ykbd_ appears in the current release, SCOPe 2.08