Lineage for d1yjwo1 (1yjw O:1-115)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824197Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 824198Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 824199Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 824291Protein Ribosomal protein L18e [52084] (1 species)
  7. 824292Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 824315Domain d1yjwo1: 1yjw O:1-115 [123479]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1ffkl_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, syb, ur3; mutant

Details for d1yjwo1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOP Domain Sequences for d1yjwo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjwo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1yjwo1:

Click to download the PDB-style file with coordinates for d1yjwo1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwo1: