Lineage for d1yjnz1 (1yjn Z:10-82)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751111Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 751112Protein Ribosomal protein L37ae [57831] (1 species)
  7. 751113Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)
  8. 751147Domain d1yjnz1: 1yjn Z:10-82 [123458]
    Other proteins in same PDB: d1yjn11, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1
    automatically matched to d1s72z_
    complexed with 1ma, cd, cl, cly, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yjnz1

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d1yjnz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjnz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOP Domain Coordinates for d1yjnz1:

Click to download the PDB-style file with coordinates for d1yjnz1.
(The format of our PDB-style files is described here.)

Timeline for d1yjnz1: