Lineage for d1yj9d1 (1yj9 D:10-174)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865505Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 865506Superfamily d.77.1: RL5-like [55282] (2 families) (S)
  5. 865507Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 865508Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 865509Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
    Uniprot P14124
  8. 865541Domain d1yj9d1: 1yj9 D:10-174 [123397]
    Other proteins in same PDB: d1yj911, d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9r1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
    automatically matched to d1ffkd_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yj9d1

PDB Entry: 1yj9 (more details), 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOP Domain Sequences for d1yj9d1:

Sequence, based on SEQRES records: (download)

>d1yj9d1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1yj9d1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1yj9d1:

Click to download the PDB-style file with coordinates for d1yj9d1.
(The format of our PDB-style files is described here.)

Timeline for d1yj9d1: