Lineage for d1yj5c1 (1yj5 C:6-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778159Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species)
  7. 2778162Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries)
  8. 2778166Domain d1yj5c1: 1yj5 C:6-110 [123384]
    Other proteins in same PDB: d1yj5a1, d1yj5a2, d1yj5b1, d1yj5b2
    complexed with so4

Details for d1yj5c1

PDB Entry: 1yj5 (more details), 2.8 Å

PDB Description: Molecular architecture of mammalian polynucleotide kinase, a DNA repair enzyme
PDB Compounds: (C:) 5' polynucleotide kinase-3' phosphatase FHA domain

SCOPe Domain Sequences for d1yj5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj5c1 b.26.1.2 (C:6-110) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
srgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavk
qlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels

SCOPe Domain Coordinates for d1yj5c1:

Click to download the PDB-style file with coordinates for d1yj5c1.
(The format of our PDB-style files is described here.)

Timeline for d1yj5c1: