SCOPe 2.03: Domain d1yiza_: 1yiz A:

Lineage for d1yiza_ (1yiz A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [186876] (5 PDB entries)

8. Domain d1yiza_: 1yiz A: [123375]
   automated match to d1w7la_
   complexed with br

Details for d1yiza_

PDB Entry: 1yiz, 1.55 Å

PDB Description: Aedes aegypti kynurenine aminotrasferase

PDB Compounds: (A:) kynurenine aminotransferase; glutamine transaminase

SCOPe Domain Sequences for d1yiza_:

Sequence; same for both SEQRES and ATOM records:

>d1yiza_ c.67.1.0 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp
hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig
sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe
cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy
rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

Timeline for d1yiza_:

• d1yiza_ first appeared in SCOP 1.73, called d1yiza1
  
• d1yiza_ appears in SCOPe 2.02
  
• d1yiza_ appears in SCOPe 2.04
  
• d1yiza_ appears in the current release, SCOPe 2.08