SCOP 1.75: Domain d1yiza1: 1yiz A:12-429

Lineage for d1yiza1 (1yiz A:12-429)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (9 families)

5. Family c.67.1.1: AAT-like [53384] (16 proteins)

6. Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species)

7. Species Yellowfever mosquito (Aedes aegypti) [TaxId:7159] [142654] (4 PDB entries)
   Uniprot Q95VY4 61-477

8. Domain d1yiza1: 1yiz A:12-429 [123375]
   automatically matched to 1YIY A:12-429
   complexed with br

Details for d1yiza1

PDB Entry: 1yiz, 1.55 Å

PDB Description: Aedes aegypti kynurenine aminotrasferase

PDB Compounds: (A:) kynurenine aminotransferase; glutamine transaminase

SCOP Domain Sequences for d1yiza1:

Sequence; same for both SEQRES and ATOM records:

>d1yiza1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]}
kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp
hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig
sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe
cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy
rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

Timeline for d1yiza1:

• d1yiza1 first appeared in SCOP 1.73
  
• d1yiza1 is called d1yiza_ in SCOPe 2.01
  
• d1yiza1 appears in the current release, SCOPe 2.08, called d1yiza_