Lineage for d1yixa1 (1yix A:1-265)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442546Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (5 proteins)
    automatically mapped to Pfam PF01026
  6. 2442553Protein Putative deoxyribonuclease YcfH [141809] (1 species)
  7. 2442554Species Escherichia coli [TaxId:562] [141810] (1 PDB entry)
    Uniprot P0AFQ7 1-265
  8. 2442555Domain d1yixa1: 1yix A:1-265 [123371]
    Other proteins in same PDB: d1yixb_
    complexed with zn

Details for d1yixa1

PDB Entry: 1yix (more details), 1.9 Å

PDB Description: crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution
PDB Compounds: (A:) deoxyribonuclease ycfH

SCOPe Domain Sequences for d1yixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]}
mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpsylhmrdlvgerdnv
vfscgvhplnqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqig
relnkpvivhtrdaradtlailreekvtdcggvlhcftedretagklldlgfyisfsgiv
tfrnaeqlrdaaryvpldrllvetdspylapvphrgkenqpamvrdvaeymavlkgvave
elaqvttdnfarlfhidasrlqsir

SCOPe Domain Coordinates for d1yixa1:

Click to download the PDB-style file with coordinates for d1yixa1.
(The format of our PDB-style files is described here.)

Timeline for d1yixa1: