SCOPe 2.08: Domain d1yixa1: 1yix A:1-265

Lineage for d1yixa1 (1yix A:1-265)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (5 proteins)
   automatically mapped to Pfam PF01026

6. Protein Putative deoxyribonuclease YcfH [141809] (1 species)

7. Species Escherichia coli [TaxId:562] [141810] (1 PDB entry)
   Uniprot P0AFQ7 1-265

8. Domain d1yixa1: 1yix A:1-265 [123371]
   Other proteins in same PDB: d1yixb_
   complexed with zn

Details for d1yixa1

PDB Entry: 1yix, 1.9 Å

PDB Description: crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution

PDB Compounds: (A:) deoxyribonuclease ycfH

SCOPe Domain Sequences for d1yixa1:

Sequence; same for both SEQRES and ATOM records:

>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]}
mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpsylhmrdlvgerdnv
vfscgvhplnqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqig
relnkpvivhtrdaradtlailreekvtdcggvlhcftedretagklldlgfyisfsgiv
tfrnaeqlrdaaryvpldrllvetdspylapvphrgkenqpamvrdvaeymavlkgvave
elaqvttdnfarlfhidasrlqsir

Timeline for d1yixa1:

• d1yixa1 first appeared in SCOP 1.73
  
• d1yixa1 appears in SCOPe 2.07