Lineage for d1yity1 (1yit Y:95-236)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690198Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 690234Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 690235Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 690236Protein Ribosomal protein L32e [52044] (1 species)
  7. 690237Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (40 PDB entries)
  8. 690247Domain d1yity1: 1yit Y:95-236 [123365]
    Other proteins in same PDB: d1yit11, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yitz1
    automatically matched to d1jj2x_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3, vir, vrs

Details for d1yity1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOP Domain Sequences for d1yity1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yity1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1yity1:

Click to download the PDB-style file with coordinates for d1yity1.
(The format of our PDB-style files is described here.)

Timeline for d1yity1: