SCOP 1.73: Domain d1yitv1: 1yit V:1-65

Lineage for d1yitv1 (1yit V:1-65)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)

8. Domain d1yitv1: 1yit V:1-65 [123362]
   Other proteins in same PDB: d1yit11, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitw1, d1yitx1, d1yity1, d1yitz1
   automatically matched to d1ffks_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3, vir, vrs

Details for d1yitv1

PDB Entry: 1yit, 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui

PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d1yitv1:

Sequence; same for both SEQRES and ATOM records:

>d1yitv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1yitv1:

• d1yitv1 is new in SCOP 1.73
  
• d1yitv1 appears in SCOP 1.75
  
• d1yitv1 appears in the current release, SCOPe 2.08