SCOPe 2.06: Domain d1yitr1: 1yit R:1-150

Lineage for d1yitr1 (1yit R:1-150)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
   Uniprot P10970

8. Domain d1yitr1: 1yit R:1-150 [123358]
   Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
   automatically matched to d1ffko_
   complexed with cd, cl, k, mg, na, vir

Details for d1yitr1

PDB Entry: 1yit, 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui

PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d1yitr1:

Sequence; same for both SEQRES and ATOM records:

>d1yitr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1yitr1:

• d1yitr1 first appeared in SCOP 1.73
  
• d1yitr1 appears in SCOPe 2.05
  
• d1yitr1 appears in SCOPe 2.07
  
• d1yitr1 appears in the current release, SCOPe 2.08