Lineage for d1yitm1 (1yit M:1-193)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175862Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2175863Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2175975Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
    automatically mapped to Pfam PF00827
  6. 2175976Protein Ribosomal protein L15e [54194] (1 species)
  7. 2175977Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
    Uniprot P60618
  8. 2175995Domain d1yitm1: 1yit M:1-193 [123353]
    Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1s72m_
    complexed with cd, cl, k, mg, na, vir

Details for d1yitm1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d1yitm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yitm1 d.12.1.2 (M:1-193) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggk

SCOPe Domain Coordinates for d1yitm1:

Click to download the PDB-style file with coordinates for d1yitm1.
(The format of our PDB-style files is described here.)

Timeline for d1yitm1: